Structure of PDB 6cza Chain B

Receptor sequence

>6czaB (length=234) Species: 94122 (Shewanella sp. ANA-3)

MRLGMVIDLQKCVGCGGCSLACKTENNTNDGIHWSHHIATTEGTFPDVKY
TYIPTLCNHCDDAPCVKVCPTGAMHKDKRGLTLQNNDECIGCKKCMNACP
YGVISFNAATPHRRWQDDSEVVANGTVSPLMLLKRTGATATPNENPERGD
TYPMIRPKRTTEKCTFCDHRLDKGLNPACVDACPSEARVIGDLDDPQSKV
SQLIKLHKPMQLKPEAGTGPRVFYIRSFGVKTAY

3D structure

• PDB: 6cza Structural and mechanistic analysis of the arsenate respiratory reductase provides insight into environmental arsenic transformations.
• Chain: B
• Resolution: 1.71 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	SF4	B	C12 V13 G14 C15 G16 C18 P54 C183 P184 R188	C12 V13 G14 C15 G16 C18 P54 C183 P184 R188
BS02	SF4	B	C22 N26 C164 F166 C167 C179	C22 N26 C164 F166 C167 C179
BS03	SF4	B	C57 N58 H59 C60 A63 P64 C65 T82 C99 Y101 V103 I104 K163	C57 N58 H59 C60 A63 P64 C65 T82 C99 Y101 V103 I104 K163
BS04	SF4	B	C69 P70 C89 I90 G91 C92 K93 C95 T161	C69 P70 C89 I90 G91 C92 K93 C95 T161

Gene Ontology

Molecular Function

• GO:0046872 metal ion binding
• GO:0051539 4 iron, 4 sulfur cluster binding

Cellular Component

• GO:0042597 periplasmic space

External links

• PDB: RCSB:6cza, PDBe:6cza, PDBj:6cza
• PDBsum: 6cza
• PubMed: 30104376
• UniProt: Q7WTT9|ARRB_SHESA Arsenate respiratory reductase iron-sulfur subunit ArrB (Gene Name=arrB)