Structure of PDB 6cxm Chain B

Receptor sequence
>6cxmB (length=155) Species: 246196 (Mycolicibacterium smegmatis MC2 155) [Search protein sequence]
SMRLIWAQSTSGIIGRDNSIPWRLPEDLARFKEMTMGHPVVMGRLTWESL
PASVRPLPGRRNIVVTRDADYRAEGAEVVTDLPDEPDAWVIGGAQIYAMA
LARADRCEVTEVDIALTPLDGDARAPVLDDSWVATTGEWQTSTSGLRFRF
CSYRR
3D structure
PDB6cxm Crystal structure of a dihydrofolate reductase from Mycobacterium smegmatis in complex with NADP and P218
ChainB
Resolution2.65 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) I6 I21 W23 D28 L29 F32 L58 A89 T111
Catalytic site (residue number reindexed from 1) I5 I20 W22 D27 L28 F31 L57 A88 T110
Enzyme Commision number 1.5.1.3: dihydrofolate reductase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 NAP B W7 A8 I15 N19 S20 I21 G44 R45 L46 T47 V66 T67 R68 T81 I92 G93 G94 A95 Q96 I97 M100 W6 A7 I14 N18 S19 I20 G43 R44 L45 T46 V65 T66 R67 T80 I91 G92 G93 A94 Q95 I96 M99
BS02 MMV B W7 D28 F32 K33 L51 L58 R61 I92 W6 D27 F31 K32 L50 L57 R60 I91
Gene Ontology
Molecular Function
GO:0000166 nucleotide binding
GO:0004146 dihydrofolate reductase activity
GO:0016491 oxidoreductase activity
GO:0050661 NADP binding
Biological Process
GO:0006730 one-carbon metabolic process
GO:0046452 dihydrofolate metabolic process
GO:0046654 tetrahydrofolate biosynthetic process
GO:0046655 folic acid metabolic process
Cellular Component
GO:0005829 cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6cxm, PDBe:6cxm, PDBj:6cxm
PDBsum6cxm
PubMed
UniProtI7FC10

[Back to BioLiP]