Structure of PDB 6ct5 Chain B

Receptor sequence
>6ct5B (length=221) Species: 1773 (Mycobacterium tuberculosis) [Search protein sequence]
TLVASVLPEDLAYAELYSDPPGLTPLPEEAPLIARSVAKRRNEFITVRHC
ARIALDQLGVPPAPILKGDKGEPCWPDGMVGSLTHCAGYRGAVVGRRDAV
RSVGIDAEPHDVLPNGVLDAISLPAERADMPRTMPAALHWDRILFCAKEA
TYKAWFPLTKRWLGFEDAHITFETDSTGWTGRFVSRILIDGSTLSGPPLT
TLRGRWSVERGLVLTAIVLAG
3D structure
PDB6ct5 Opposing reactions in coenzyme A metabolism sensitizeMycobacterium tuberculosisto enzyme inhibition.
ChainB
Resolution1.75935 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 FD7 B I129 F153 I121 F145 MOAD: ic50=2.5uM
BS02 COA B R48 R56 K75 K78 G79 E80 P81 L91 T92 H93 Y160 K161 F164 R40 R48 K67 K70 G71 E72 P73 L83 T84 H85 Y152 K153 F156
BS03 FD7 B K156 E157 Y160 W170 L171 G172 F173 K148 E149 Y152 W162 L163 G164 F165 MOAD: ic50=2.5uM
Gene Ontology
--> -->
 
 
UnboundLocalError
Python 3.6.8: /usr/bin/python3
Sat Feb 22 16:53:39 2025

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '6ct5', asym_id = 'B', title = 'Opposing reactions in coenzyme A metabolism sensitizeMycobacterium tuberculosisto enzyme inhibition.'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='6ct5', asym_id='B', title='Opposing reactions in coenzyme A metabolism sensitizeMycobacterium tuberculosisto enzyme inhibition.')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0000287,0008897,0009239,0009366,0016780', uniprot = '', pdbid = '6ct5', asym_id = 'B'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0000287,0008897,0009239,0009366,0016780', uniprot='', pdbid='6ct5', asym_id='B')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>