Structure of PDB 6csd Chain B

Receptor sequence

>6csdB (length=454) Species: 9606 (Homo sapiens) [Search protein sequence]

GKLPPGPFQNTPYCFDQLRRRFGDVFSLQLAWTPVVVLNGLAAVREALVT
HGEDTADRPPVPITQILGFGPRSQGVFLARYGPAWREQRRFSVSTLRNLG
LGKKSLEQWVTEEAACLCAAFANHSGRPFRPNGLLDKAVSNVIASLTCGR
RFEYDDPRFLRLLDLAQEGLKEESGFLREVLNAVPVLLHIPALAGKVLRF
QKAFLTQLDELLTEHRMTWDPAQPPRDLTEAFLAEMEKAKGNPESSFNDE
NLRIVVADLFSAGMETTSTTLAWGLLLMILHPDVQRRVQQEIDDVIGQVR
RPEMGDQAHMPYTTAVIHEVQRFGDIVPLGVTHMTSRDIEVQGFRIPKGT
TLITNLSSVLKDEAVWEKPFRFHPEHFLDAQGHFVKPEAFLPFSAGRRAC
LGEPLARMELFLFFTSLLQHFSFSVPTGQPRPSHHGVFAFLVSPSPYELC
AVPR

3D structure

PDB

6csd Characteristic conformational changes on the distal and proximal surfaces of cytochrome P450 2D6 in response to substrate binding

Chain

Resolution

2.391 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

1.14.14.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	HEM	B	R101 V119 F120 W128 R132 A305 G306 T309 I369 V374 H376 F436 S437 R441 C443 G445	R58 V76 F77 W85 R89 A262 G263 T266 I326 V331 H333 F393 S394 R398 C400 G402
BS02	PN0	B	L110 F120 L213 E216 Q244 A300 D301 S304 A305 E308 T309 F483	L67 F77 L170 E173 Q201 A257 D258 S261 A262 E265 T266 F440
BS03	ZN	B	H258 D270 E273	H215 D227 E230

Gene Ontology

	Molecular Function
GO:0004497	monooxygenase activity
GO:0005506	iron ion binding
GO:0016491	oxidoreductase activity
GO:0016705	oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen
GO:0016712	oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen
GO:0020037	heme binding
GO:0046872	metal ion binding
GO:0062187	anandamide 8,9 epoxidase activity
GO:0062188	anandamide 11,12 epoxidase activity
GO:0062189	anandamide 14,15 epoxidase activity

	Biological Process
GO:0006631	fatty acid metabolic process
GO:0006805	xenobiotic metabolic process
GO:0008202	steroid metabolic process
GO:0008203	cholesterol metabolic process
GO:0008210	estrogen metabolic process
GO:0009804	coumarin metabolic process
GO:0009820	alkaloid metabolic process
GO:0009822	alkaloid catabolic process
GO:0016098	monoterpenoid metabolic process
GO:0019369	arachidonate metabolic process
GO:0033076	isoquinoline alkaloid metabolic process
GO:0042178	xenobiotic catabolic process
GO:0042572	retinol metabolic process
GO:0042759	long-chain fatty acid biosynthetic process
GO:0051100	negative regulation of binding
GO:0070989	oxidative demethylation
GO:0090350	negative regulation of cellular organofluorine metabolic process

	Cellular Component
GO:0005737	cytoplasm
GO:0005739	mitochondrion
GO:0005783	endoplasmic reticulum
GO:0005789	endoplasmic reticulum membrane
GO:0016020	membrane
GO:0043231	intracellular membrane-bounded organelle

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6csd, PDBe:6csd, PDBj:6csd
PDBsum	6csd
PubMed
UniProt	P10635\|CP2D6_HUMAN Cytochrome P450 2D6 (Gene Name=CYP2D6)

[Back to BioLiP]