Structure of PDB 6cpd Chain B |
>6cpdB (length=127) Species: 622637 (Methylocystis sp. ATCC 49242) [Search protein sequence] |
MGNMCMVMFGYDMIHITVFQPDKSRSEYCDEIPATGRTIMAFDIENPAFR DLPLELRIIRDPLTPVLPTGEKELDALTELHLPAKKYSKGTFSVEHNFAN NGHYIGLVTLTRESGQQETAQFKFMVG |
|
PDB | 6cpd Characterization of a long overlooked copper protein from methane- and ammonia-oxidizing bacteria. |
Chain | B |
Resolution | 1.903 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CU1 |
B |
M42 M44 |
M6 M8 |
|
|
|
|