Structure of PDB 6cko Chain B |
>6ckoB (length=67) Species: 9606 (Homo sapiens) [Search protein sequence] |
AASIEQLLERQWSEGQQFLLEQGTPSDILGMLKSLHQLQVENRRLEEQIK NLTAKKERLQLLNAQLS |
|
PDB | 6cko Structural and functional analysis of the DOT1L-AF10 complex reveals mechanistic insights into MLL-AF10-associated leukemogenesis. |
Chain | B |
Resolution | 2.0 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
B |
E737 H764 |
E9 H36 |
|
|
|