Structure of PDB 6chv Chain B

Receptor sequence
>6chvB (length=88) Species: 585 (Proteus vulgaris) [Search protein sequence]
KVSHPGEMIARDLEDMGVSGRRFAHNIGVTPATVSRLLAGKTALTPSLSI
RIAAALGSTPEFWLRLQSNYDLRQLENQIDTSGIVLYG
3D structure
PDB6chv Structural basis of transcriptional regulation by the HigA antitoxin.
ChainB
Resolution2.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna B S23 G24 R25 A36 S39 K45 S19 G20 R21 A32 S35 K41 PDBbind-CN: Kd=125nM
BS02 dna B T34 A36 T37 R40 T46 A47 T49 L52 T30 A32 T33 R36 T42 A43 T45 L48 PDBbind-CN: Kd=125nM
Gene Ontology
Molecular Function
GO:0000976 transcription cis-regulatory region binding
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0005515 protein binding
GO:0046982 protein heterodimerization activity
GO:0097351 toxin sequestering activity
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:6chv, PDBe:6chv, PDBj:6chv
PDBsum6chv
PubMed30793388
UniProtQ7A224|HIGA_PROVU Antitoxin HigA (Gene Name=higA)

[Back to BioLiP]