Structure of PDB 6cdb Chain B |
>6cdbB (length=95) Species: 1280 (Staphylococcus aureus) [Search protein sequence] |
INTDTLERVTEIFKALGDYNRIRIMELLSVSEASVGHISHQLNLSQSNVS HQLKLLKSLHLVKAKRQGQSMIYSLDDIHVATMLKQAIHHANHPK |
|
PDB | 6cdb Functional Role of Solvent Entropy and Conformational Entropy of Metal Binding in a Dynamically Driven Allosteric System. |
Chain | B |
Resolution | 1.99 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
B |
H97 H100 |
H90 H93 |
|
|
|
|