Structure of PDB 6bsf Chain B

Receptor sequence
>6bsfB (length=73) Species: 9606 (Homo sapiens) [Search protein sequence]
HMKLCLVCSDEASGCHYGVLTCGSCKVFFKRAVEGQHNYLCAGRNDCIID
KIRRKNCPACRYRKCLQAGMNLE
3D structure
PDB6bsf General and sequence-specific roles for DNA in glucocorticoid receptor DNA-binding stoichiometry
ChainB
Resolution2.4 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna B G439 S440 R447 Y455 R470 P474 R477 G23 S24 R31 Y39 R54 P58 R61
BS02 dna B G430 C431 H432 Y433 K442 K446 K471 G14 C15 H16 Y17 K26 K30 K55
BS03 ZN B C421 C424 C438 C441 C5 C8 C22 C25
BS04 ZN B C457 C463 C473 C476 C41 C47 C57 C60
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0008270 zinc ion binding
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:6bsf, PDBe:6bsf, PDBj:6bsf
PDBsum6bsf
PubMed
UniProtP79269|GCR_SAGOE Glucocorticoid receptor (Gene Name=NR3C1)

[Back to BioLiP]