Structure of PDB 6bra Chain B

Receptor sequence

>6braB (length=99) Species: 11676 (Human immunodeficiency virus 1)

PQITLWKRPLVTIKIGGQLKEALLNTGADDTVIEEMSLPGRWKPKMIGGI
GGFIKVRQYDQIIIEIAGHKAIGTVLVGPTPVNIIGRNLLTQIGATLNF

3D structure

• PDB: 6bra A substrate selected by phage display exhibits enhanced side-chain hydrogen bonding to HIV-1 protease.
• Chain: B
• Resolution: 1.111 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): N25 T26 G27
• Catalytic site (residue number reindexed from 1): N25 T26 G27

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	B	N25 G27 A28 D29 D30 K45 I47 G48 I50 V82	N25 G27 A28 D29 D30 K45 I47 G48 I50 V82

Gene Ontology

Molecular Function

• GO:0004190 aspartic-type endopeptidase activity

Biological Process

• GO:0006508 proteolysis

External links

• PDB: RCSB:6bra, PDBe:6bra, PDBj:6bra
• PDBsum: 6bra
• PubMed: 29968678
• UniProt: Q5RZ08