Structure of PDB 6bjg Chain B

Receptor sequence
>6bjgB (length=146) Species: 39443 (Carnation Italian ringspot virus) [Search protein sequence]
MERAIQGNDTREQANGERWDGGSGGITSPFKLPDESPSWTEWRLYNDETQ
DNPLGFKESWGFGKVVFKRYLRYDRTEASLHRVLGSWTGDSVNYAASRFL
GANQVGCHYSIRFRGVSVTISGGSRTLQHLCEMAIRSKQELLQLTP
3D structure
PDB6bjg Structural insights into interactions between viral suppressor of RNA silencing protein p19 mutants and small RNAs.
ChainB
Resolution2.29 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna B R18 W19 P37 W39 W42 K60 Q107 V108 G109 S124 G125 R18 W19 P37 W39 W42 K57 Q104 V105 G106 S121 G122
BS02 rna B R11 W39 K67 H111 S113 R115 S120 R11 W39 K64 H108 S110 R112 S117
Gene Ontology
Biological Process
GO:0019049 virus-mediated perturbation of host defense response
GO:0052170 symbiont-mediated suppression of host innate immune response
Cellular Component
GO:0044423 virion component

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6bjg, PDBe:6bjg, PDBj:6bjg
PDBsum6bjg
PubMed31021526
UniProtQ66104|P19_CIRV RNA silencing suppressor p19 (Gene Name=ORF4)

[Back to BioLiP]