Structure of PDB 6b11 Chain B

Receptor sequence

>6b11B (length=383) Species: 1906 (Streptomyces fradiae)

SIAWPVARTCPFSPPEQYAALRAEEPIARAELWDGAPVWLISRQDHVRAL
LADPRVSIHPAKLPRLSPSDGEAEASRSLLTLDPPDHGALRGHFIPEFGL
RRVRELRPSVEQIVTGLLDDLTARGDEADLLADFALPMATQVICRLLDIP
YEDRDYFQERTEQATRPAAGEEALEALLELRDYLDRLISGKDGMLGSMVA
QARGGGLSHADVLDNAVLLLAAGHETTASMVTMSVLVLLQHPTAWRELTV
NPGLLPGAVDELLRYLSIADGLRRSATADIEIDGHTIRAGDGLVFLLAAA
NRDEAVFSEPEAFDIHRSARRHVAFGYGPHQCLGQNLARMELEVALGAVL
ERLPALRPTTDVAGLRLKSDSAVFGVYELPVAW

3D structure

• PDB: 6b11 TylHI in complex with native substrate 23-deoxy-5-O-mycaminosyl-tylonolide (23-DMTL)
• Chain: B
• Resolution: 1.99 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): R197 E262 T263 C369 L370 G371
• Catalytic site (residue number reindexed from 1): R166 E225 T226 C332 L333 G334
• Enzyme Commision number: 1.14.15.34: 20-oxo-5-O-mycaminosyltylactone 23-monooxygenase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEM	B	L110 L111 H118 R122 F129 G260 T263 L309 R311 A361 F362 H367 C369 G371 A375	L79 L80 H87 R91 F98 G223 T226 L272 R274 A324 F325 H330 C332 G334 A338
BS02	CGM	B	G102 E103 E105 A195 P198 A204 L205 V254 L255 A258 A409	G71 E72 E74 A164 P167 A173 L174 V217 L218 A221 A372

Gene Ontology

Molecular Function

• GO:0004497 monooxygenase activity
• GO:0005506 iron ion binding
• GO:0016705 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen
• GO:0020037 heme binding
• GO:0046872 metal ion binding

Biological Process

• GO:0016999 antibiotic metabolic process
• GO:0017000 antibiotic biosynthetic process

External links

• PDB: RCSB:6b11, PDBe:6b11, PDBj:6b11
• PDBsum: 6b11
• UniProt: Q9ZHQ1|TYLH1_STRFR 20-oxo-5-O-mycaminosyltylactone 23-monooxygenase (Gene Name=tylH1)