Structure of PDB 6ayq Chain B

Receptor sequence

>6ayqB (length=228) Species: 197 (Campylobacter jejuni)

MKIAILGAMSEEITPLLETLKDYTKIEHANNTYYFAKYKDHELVLAYSKI
GKVNSTLSASVMIEKFGAQVLLFTGVAGAFNPELEIGDLLYATKLAQYDL
DITAFGHPLGFVPGNEIFIKTDEKLNNLALEVAKELNIKLRAGIIATGDE
FICDEAKKAKIREIFNADACEMEGASVALVCDALKVPCFILRAMSDKAGE
KAEFDFDEFVINSAKISANFVLKMCEKL

3D structure

• PDB: 6ayq Transition-State Analogues of Campylobacter jejuni 5'-Methylthioadenosine Nucleosidase.
• Chain: B
• Resolution: 1.42 Å

Enzymatic activity

• Enzyme Commision number: 3.2.2.30: aminodeoxyfutalosine nucleosidase.
  3.2.2.9: adenosylhomocysteine nucleosidase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	TDI	B	M9 I50 V76 A77 G78 F151 I152 C170 E171 M172 E173 D196	M9 I50 V76 A77 G78 F151 I152 C170 E171 M172 E173 D196	MOAD: Ki=6.5nM PDBbind-CN: -logKd/Ki=8.19,Ki=6.5nM

Gene Ontology

Molecular Function

• GO:0003824 catalytic activity
• GO:0008782 adenosylhomocysteine nucleosidase activity
• GO:0008930 methylthioadenosine nucleosidase activity
• GO:0016787 hydrolase activity
• GO:0102246 6-amino-6-deoxyfutalosine hydrolase activity

Biological Process

• GO:0009086 methionine biosynthetic process
• GO:0009116 nucleoside metabolic process
• GO:0009164 nucleoside catabolic process
• GO:0009234 menaquinone biosynthetic process
• GO:0019284 L-methionine salvage from S-adenosylmethionine
• GO:0019509 L-methionine salvage from methylthioadenosine

Cellular Component

• GO:0005829 cytosol

External links

• PDB: RCSB:6ayq, PDBe:6ayq, PDBj:6ayq
• PDBsum: 6ayq
• PubMed: 30339406
• UniProt: Q0PC20|MQMTN_CAMJE Aminodeoxyfutalosine nucleosidase (Gene Name=pfs)