Structure of PDB 6apv Chain B

Receptor sequence

>6apvB (length=183) Species: 5702 (Trypanosoma brucei brucei)

CKYDFATSVLFTEAELHTRMRGVAQRIADDYSNCNLKPLENPLVIVSVLK
GSFVFTADMVRILGDFGVPTRVEFLRASSYDIRGKHVLVLEDILDTALTL
REVVDSLKKSEPASIKTLVAIDKPGGRKIPFTAEYVVADVPNVFVVGYGL
DYDQSYREVRDVVILKPSVYETWGKELERRKAA

3D structure

• PDB: 6apv Evaluation of the Trypanosoma brucei 6-oxopurine salvage pathway as a potential target for drug discovery.
• Chain: B
• Resolution: 1.993 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): E113 D114 D117 F166 R179
• Catalytic site (residue number reindexed from 1): E91 D92 D95 F144 R157
• Enzyme Commision number: 2.4.2.8: hypoxanthine phosphoribosyltransferase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	3L4	B	K54 G55 I115 D117 T118 A119 T121 K145 F166 V167 D173 R179	K50 G51 I93 D95 T96 A97 T99 K123 F144 V145 D151 R157	MOAD: Ki=0.11uM PDBbind-CN: -logKd/Ki=6.96,Ki=0.11uM

Gene Ontology

Molecular Function

• GO:0000166 nucleotide binding
• GO:0000287 magnesium ion binding
• GO:0004422 hypoxanthine phosphoribosyltransferase activity
• GO:0016757 glycosyltransferase activity
• GO:0046872 metal ion binding
• GO:0052657 guanine phosphoribosyltransferase activity

Biological Process

• GO:0006166 purine ribonucleoside salvage
• GO:0006178 guanine salvage
• GO:0032263 GMP salvage
• GO:0032264 IMP salvage
• GO:0046100 hypoxanthine metabolic process

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0020015 glycosome
• GO:0031981 nuclear lumen
• GO:0097014 ciliary plasm

External links

• PDB: RCSB:6apv, PDBe:6apv, PDBj:6apv
• PDBsum: 6apv
• PubMed: 29481567
• UniProt: Q07010|HPRT_TRYBB Hypoxanthine-guanine phosphoribosyltransferase (Gene Name=HGPRT)