Structure of PDB 6ale Chain B

Receptor sequence

>6aleB (length=95) Species: 9606 (Homo sapiens)

GRKLELTKAEKHFHNFMMDTQLTKRVKNAAANVLRETWLIYKNTKLVKKI
DHAKVRKHQRKFLQAIHQLRSVKMEQRKLNDQANTLVDLAKTQLE

3D structure

• PDB: 6ale A V-to-F substitution in SK2 channels causes Ca2+hypersensitivity and improves locomotion in a C. elegans ALS model.
• Chain: B
• Resolution: 2.5 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	1KP	B	N409 F410 A477	N15 F16 A83

Gene Ontology

Molecular Function

• GO:0005516 calmodulin binding
• GO:0015269 calcium-activated potassium channel activity
• GO:0016286 small conductance calcium-activated potassium channel activity

Biological Process

• GO:0006813 potassium ion transport

Cellular Component

• GO:0016020 membrane

External links

• PDB: RCSB:6ale, PDBe:6ale, PDBj:6ale
• PDBsum: 6ale
• PubMed: 30013223
• UniProt: Q9H2S1|KCNN2_HUMAN Small conductance calcium-activated potassium channel protein 2 (Gene Name=KCNN2)