Structure of PDB 6a7t Chain B |
>6a7tB (length=138) Species: 311201 (Saxidomus purpurata) [Search protein sequence] |
CCSEDDCPSGWKFFGGSCYLFDEGSRGWEGSKAFCESKDASLVTVECSKE DDFIRGILSGQTAKHYYWIGARWNEEHNDYRWIDGSPFTFIGWGPGKPDN NKGCLDYLNYKEVVWQWNDHVDCENTNGPCICEIDCSD |
|
PDB | 6a7t Novel Ca2+-independent carbohydrate recognition of the C-type lectins, SPL-1 and SPL-2, from the bivalve Saxidomus purpuratus. |
Chain | B |
Resolution | 1.6 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CA |
B |
T44 E46 E50 E133 |
T44 E46 E50 E133 |
|
|
|