Structure of PDB 6a5d Chain B |
>6a5dB (length=93) Species: 3702 (Arabidopsis thaliana) [Search protein sequence] |
KKTCPVNFEFMNYTIITSKCKGPKYPPKECCGAFKDFACPYTDQLNDLSS DCATTMFSYINLYGKYPPGLFANQCKEGKEGLECPAGSQLPPE |
|
PDB | 6a5d Mechanisms of RALF peptide perception by a heterotypic receptor complex. |
Chain | B |
Resolution | 1.401 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
FUC |
B |
M56 Y86 |
M11 Y41 |
|
|
|
|