Structure of PDB 6a54 Chain B |
>6a54B (length=126) Species: 335992 (Candidatus Pelagibacter ubique HTCC1062) [Search protein sequence] |
MIFVKNLASVLSQEWSSTEKYPGVRWKFLIDADFDGSSGLSLGFAEIAPG GDLTLHYHSPAEIAVVTNGKGILNKSGKLETIKKGDVVYIAGNAEHALKN NGKETLEFYWIFPTDRFSEVEYFPAK |
|
PDB | 6a54 Structure-Function Analysis Indicates that an Active-Site Water Molecule Participates in Dimethylsulfoniopropionate Cleavage by DddK. |
Chain | B |
Resolution | 2.3 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
MN |
B |
H56 H58 E62 H96 |
H56 H58 E62 H96 |
|
|
|
|