Structure of PDB 6a4z Chain B |
>6a4zB (length=127) Species: 1969 (Streptomyces chartreusis) [Search protein sequence] |
MAVELNHTIVLVKDKDASATFMADLLGLPKPKEMGPFAVLQLANDVSIDF MDFRGEGDIVPGHCAFLISDEEFDQIFGRIREGGIEHWADQYHREPGRIN DRDGGRGVYFEDPSGHNMEIMTRPYGS |
|
PDB | 6a4z Molecular Basis for the Final Oxidative Rearrangement Steps in Chartreusin Biosynthesis. |
Chain | B |
Resolution | 1.7 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
FE2 |
B |
H63 E119 Y125 |
H63 E119 Y125 |
|
|
|
|