Structure of PDB 6a2f Chain B

Receptor sequence

>6a2fB (length=358) Species: 208964 (Pseudomonas aeruginosa PAO1)

MRPLVATVDLSAIRHNYALAKRCAPQRQAFAVVKANAYGHGAREVVTALH
DDADGFAVACLEEAAEVRALHASARILLLEGCFEASEYALAGQLRLDLVI
QGAEQGEAFLAAGLDIPLNVWLKLDSGMHRLGFDPAALRAWHARLRSHPG
VRELNLISHFACADERNHPLTEQQLESFLGLLDLDFDQRSLANSAAVLTI
PAAHMDWLRPGIMLYGSTPLADLSAAELGLKPAMSLGAQLISLREVAVGE
SVGYGATWIAERPARIGTVSCGYADGYPRTAPAGTPVLVGGRRAILAGRV
SMDMLAVDLSDLPEARVGDPVELWGAGLSVDEVARACGTLGYELLSKVTA
RVPRRYSH

3D structure

• PDB: 6a2f Enzymatic characterization and crystal structure of biosynthetic alanine racemase from Pseudomonas aeruginosa PAO1.
• Chain: B
• Resolution: 2.5 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): K34 R130 H159 R209 Y254 S301 D303
• Catalytic site (residue number reindexed from 1): K34 R130 H159 R209 Y254 S301 D303
• Enzyme Commision number: 5.1.1.1: alanine racemase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	DLY	B	X34 Y342	X34 Y342
BS02	DLY	B	Y254 Y273 S301 M302 D303 M304	Y254 Y273 S301 M302 D303 M304
BS03	ACT	B	Y254 R279	Y254 R279
BS04	MLI	B	K123 M128 R130 L131	K123 M128 R130 L131

Gene Ontology

Molecular Function

• GO:0003824 catalytic activity
• GO:0008784 alanine racemase activity
• GO:0016853 isomerase activity
• GO:0030170 pyridoxal phosphate binding

Biological Process

• GO:0006522 alanine metabolic process
• GO:0008360 regulation of cell shape
• GO:0009252 peptidoglycan biosynthetic process
• GO:0030632 D-alanine biosynthetic process
• GO:0071555 cell wall organization

Cellular Component

• GO:0005829 cytosol

External links

• PDB: RCSB:6a2f, PDBe:6a2f, PDBj:6a2f
• PDBsum: 6a2f
• PubMed: 29964014
• UniProt: Q9HUN4|ALR1_PSEAE Alanine racemase, biosynthetic (Gene Name=alr)