Structure of PDB 5zt1 Chain B

Receptor sequence

>5zt1B (length=339) Species: 623 (Shigella flexneri) [Search protein sequence]

SHMHTQVGRGLLGAVVNPLGEVTDKFAVTDNSEILYRPVDNAPPLYSERA
AIEKPFLTGIKVIDSLLTCGEGQRMGIFASAGCGKTFLMNMLIEHSGADI
YVIGLIGERGREVTETVDYLKNSEKKSRCVLVYATSDYSSVDRCNAAYIA
TAIAEFFRTEGHKVALFIDSLTRYARALRDVALAAGESPARRGYPVSVFD
SLPRLLERPGKLKAGGSITAFYTVLLEDDDFADPLAEEVRSILDGHIYLS
RNLAQKGQFPAIDSLKSISRVFTQVVDEKHRIMAAAFRELLSEIEEPGEN
ASQDKIYNKISVVESFLKQDYRLGFTYEQTMELIGETIR

3D structure

PDB

5zt1 Structural Insight Into Conformational Changes Induced by ATP Binding in a Type III Secretion-Associated ATPase FromShigella flexneri

Chain

Resolution

3.114 Å

3D
structure

Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Catalytic site (original residue number in PDB)	K165 E188 R189 R350
Catalytic site (residue number reindexed from 1)	K85 E108 R109 R270
Enzyme Commision number	7.4.2.8: protein-secreting ATPase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	MG	B	V244 S297 T299	V164 S217 T219
BS02	MG	B	S160 G162 K165	S80 G82 K85
BS03	MG	B	T231 L285 Y302	T151 L205 Y222
BS04	MG	B	R154 E287 I322	R74 E207 I242
BS05	MG	B	A159 S160 L329	A79 S80 L249
BS06	MG	B	D310 P314 A316 E317	D230 P234 A236 E237
BS07	MG	B	E235 R238	E155 R158
BS08	MG	B	K141 V142 Q410	K61 V62 Q319
BS09	MG	B	F136 D144 T148 C149	F56 D64 T68 C69
BS10	MG	B	T252 L305 D313	T172 L225 D233
BS11	MG	B	L323 G325 R350	L243 G245 R270
BS12	MG	B	F167 M171	F87 M91
BS13	MG	B	M169 F247	M89 F167
BS14	MG	B	L137 K243	L57 K163

Gene Ontology

	Molecular Function
GO:0005524	ATP binding
GO:0016887	ATP hydrolysis activity

	Biological Process
GO:0009058	biosynthetic process
GO:0030254	protein secretion by the type III secretion system

	Cellular Component
GO:0005737	cytoplasm
GO:0030257	type III protein secretion system complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:5zt1, PDBe:5zt1, PDBj:5zt1
PDBsum	5zt1
PubMed	30013545
UniProt	P0A1C1\|SCTN_SHIFL Type 3 secretion system ATPase (Gene Name=sctN)

[Back to BioLiP]