Structure of PDB 5zjq Chain B

Receptor sequence
>5zjqB (length=73) Species: 7227 (Drosophila melanogaster) [Search protein sequence]
ARRKRRNFSKQASEILNEYFYSHLSNPYPSEEAKEELARKCGITVSQVSN
WFGNKRIRYKKNIGKAQEEANLY
3D structure
PDB5zjq Intrinsic DNA Shape Accounts for Affinity Differences between Hox-Cofactor Binding Sites.
ChainB
Resolution2.443 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna B R4 R6 Y29 R57 I58 K61 R3 R5 Y28 R56 I57 K60
BS02 dna B R3 R4 R6 N8 F9 Q48 N51 W52 N55 R59 R2 R3 R5 N7 F8 Q47 N50 W51 N54 R58
Gene Ontology
Molecular Function
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003677 DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:5zjq, PDBe:5zjq, PDBj:5zjq
PDBsum5zjq
PubMed30157419
UniProtP40427|EXD_DROME Homeobox protein extradenticle (Gene Name=exd)

[Back to BioLiP]