Structure of PDB 5z0h Chain B |
>5z0hB (length=73) Species: 79261 (Streptomyces castaneoglobisporus) [Search protein sequence] |
AAPESFDEVYKGRRIQGRPAGYEVFVDGVQLHVMRNADGSWISVVSHFDP VPTPRAAARAAVDELQGAPLLPF |
|
PDB | 5z0h Catalytic mechanism of tyrosinase implied from the quinone formation on the Tyr98 residue of the caddie protein |
Chain | B |
Resolution | 1.18 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CU |
B |
H82 M84 H97 |
H32 M34 H47 |
|
|
|
|