Structure of PDB 5z0d Chain B |
>5z0dB (length=80) Species: 79261 (Streptomyces castaneoglobisporus) [Search protein sequence] |
AAPESFDEVYKGRRIQGRPAHEHGGGYEVFVDGVQLHVMRNADGSWISVV SHYDPVPTPRAAARAAVDELQGAPLLPFPA |
|
PDB | 5z0d Catalytic mechanism of tyrosinase implied from the quinone formation on the Tyr98 residue of the caddie protein |
Chain | B |
Resolution | 1.16 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CU |
B |
E67 H68 H82 |
E22 H23 H37 |
|
|
|
|