Structure of PDB 5yy0 Chain B

Receptor sequence

>5yy0B (length=126) Species: 69014 (Thermococcus kodakarensis KOD1)

HEWALADAIVRTVLDYAQREGASRVKAVRVVLGELQDVAEDIVKFAMEQL
FAGTIAEGAEIEFVEEEAVFKCRNCNYEWKLKEVKDKIHFIPEVVHAFLA
CPKCGSHDFEVVKGRGVYVAGIKIEK

3D structure

• PDB: 5yy0 Crystal structures of a [NiFe] hydrogenase large subunit HyhL in an immature state in complex with a Ni chaperone HypA.
• Chain: B
• Resolution: 3.243 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ZN	B	C73 C76 C110 C113	C72 C75 C101 C104

Gene Ontology

Molecular Function

• GO:0008270 zinc ion binding
• GO:0016151 nickel cation binding
• GO:0046872 metal ion binding

Biological Process

• GO:0036211 protein modification process
• GO:0051604 protein maturation

External links

• PDB: RCSB:5yy0, PDBe:5yy0, PDBj:5yy0
• PDBsum: 5yy0
• PubMed: 29915046
• UniProt: Q5JIH3|HYPA_THEKO Hydrogenase maturation factor HypA (Gene Name=hypA)