Structure of PDB 5yng Chain B |
>5yngB (length=146) Species: 1833 (Rhodococcus erythropolis) [Search protein sequence] |
KIEQPRWASKDSAAGAASTPDEKIVLEFMDALTSNDAAKLIEYFAEDTMY QNMPLPPAYGRDAVEQTLAGLFTVMSYDAVETFHIGSSNGLVYTERVDVL RALPTGKSYNVSVLGVFQLTEGKITGWRDYFDLREFEEAVDLPLRG |
|
PDB | 5yng Structural and Computational Insight into the Catalytic Mechanism of Limonene Epoxide Hydrolase Mutants in Stereoselective Transformations. |
Chain | B |
Resolution | 2.497 Å |
3D structure |
|
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
3ZS |
B |
N55 M78 L103 F134 |
N52 M75 L100 F131 |
|
|
|
|