Structure of PDB 5yir Chain B |
>5yirB (length=117) Species: 10090 (Mus musculus) [Search protein sequence] |
MKFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYL VPSDLTVGQFYFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHHE EDFFLYIAYSDESVYGL |
|
PDB | 5yir Potent and specific Atg8-targeting autophagy inhibitory peptides from giant ankyrins. |
Chain | B |
Resolution | 2.75 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
|
|
Biological Process |
GO:0000226 |
microtubule cytoskeleton organization |
GO:0006914 |
autophagy |
GO:0006915 |
apoptotic process |
GO:0008625 |
extrinsic apoptotic signaling pathway via death domain receptors |
GO:0015031 |
protein transport |
GO:0032436 |
positive regulation of proteasomal ubiquitin-dependent protein catabolic process |
GO:0035020 |
regulation of Rac protein signal transduction |
GO:0098696 |
regulation of neurotransmitter receptor localization to postsynaptic specialization membrane |
GO:1902524 |
positive regulation of protein K48-linked ubiquitination |
|
|