Structure of PDB 5yef Chain B

Receptor sequence

>5yefB (length=167) Species: 9606 (Homo sapiens) [Search protein sequence]

PHKCPDCDMAFVGELVRHRRYKHTHEKPFKCSMCDYASVEVSKLKRHIRS
HTGERPFQCSLCSYASRDTYKLKRHMRTHSGEKPYECYICHARFTQSGTM
KMHILQKHTENVAKFHCPHCDTVIARKSDLGVHLRKQHSYIEQGKKCRYC
DAVFHERYALIQHQKSH

3D structure

PDB

5yef Molecular mechanism of directional CTCF recognition of a diverse range of genomic sites

Chain

Resolution

2.807 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	dna	B	Y392 S450	Y70 S128
BS02	dna	B	R339 H340 Y343 K344 E362 K365 R368 H369 S372 R377 Y386 R389 K393 R396 H397 T400 K405 F416 T417 Q418 T421 H425 K429 I446 R448 D451 H455 R479	R17 H18 Y21 K22 E40 K43 R46 H47 S50 R55 Y64 R67 K71 R74 H75 T78 K83 F94 T95 Q96 T99 H103 K107 I124 R126 D129 H133 R157
BS03	ZN	B	C324 C327 H340 H345	C4 C7 H18 H23
BS04	ZN	B	C353 H369 H373	C31 H47 H51
BS05	ZN	B	C381 C384 H397 H401	C59 C62 H75 H79
BS06	ZN	B	C409 C412 H425 H430	C87 C90 H103 H108
BS07	ZN	B	C439 C442 H455 H460	C117 C120 H133 H138
BS08	ZN	B	C469 C472 H485 H489	C147 C150 H163 H167

External links

PDB	RCSB:5yef, PDBe:5yef, PDBj:5yef
PDBsum	5yef
PubMed	29076501
UniProt	P49711\|CTCF_HUMAN Transcriptional repressor CTCF (Gene Name=CTCF)

[Back to BioLiP]