Structure of PDB 5xen Chain B

Receptor sequence

>5xenB (length=301) Species: 190304 (Fusobacterium nucleatum subsp. nucleatum ATCC 25586)

LANSVIDLIGNTPLVKINNIDTFGNEIYVKLEGSNPGRSTKDRIALKMIE
EAEKEGLIDKDTVIIEATSGNTGIGLAMICAVKNYKLKIVMPDTMSIERI
QLMRAYGTEVILTDGSLGMKACLEKLEELKKNEKKYFVPNQFTNVNNPKA
HYETTAEEILKDLNNKVDVFICGTGTGGSFSGTAKKLKEKLPNIKTFPVE
PASSPLLSKGYIGPHKIQGMGMSIGGIPAVYDGSLADDILVCEDDDAFEM
MRELSFKEGILGGISTGATFKAALDYSKENADKGLKIVVLSTDSGEKYLS
N

3D structure

• PDB: 5xen Purification, crystallization and preliminary X-ray analysis of two hydrogen sulfide-producing enzymes from Fusobacterium nucleatum.
• Chain: B
• Resolution: 1.94 Å

Enzymatic activity

• Enzyme Commision number: 2.5.1.47: cysteine synthase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	PLP	B	K42 N72 T175 G176 T177 G178 S180 G220 S266 T293 D294	K41 N71 T174 G175 T176 G177 S179 G219 S265 T292 D293
BS02	SER	B	K42 T69 S70 N72 T73 Q142	K41 T68 S69 N71 T72 Q141
BS03	PLP	B	K42 N72 T175 G176 T177 G178 S180 G220 S266 T293 D294	K41 N71 T174 G175 T176 G177 S179 G219 S265 T292 D293
BS04	CA	B	E244 D246	E243 D245

Gene Ontology

Molecular Function

• GO:0004124 cysteine synthase activity
• GO:0016740 transferase activity
• GO:0046872 metal ion binding
• GO:0080146 L-cysteine desulfhydrase activity

Biological Process

• GO:0006534 cysteine metabolic process
• GO:0006535 cysteine biosynthetic process from serine
• GO:0009069 serine family amino acid metabolic process
• GO:0044272 sulfur compound biosynthetic process

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:5xen, PDBe:5xen, PDBj:5xen
• PDBsum: 5xen
• UniProt: Q8RE94