Structure of PDB 5x0x Chain B

Receptor sequence
>5x0xB (length=82) Species: 8355 (Xenopus laevis) [Search protein sequence]
KVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDA
VTYTEHAKRKTVTAMDVVYALKRQGRTLYGFG
3D structure
PDB5x0x Mechanism of chromatin remodelling revealed by the Snf2-nucleosome structure.
ChainB
Resolution3.97 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna B R45 I46 G48 R78 K79 T80 R26 I27 G29 R59 K60 T61
BS02 dna B P32 R36 R45 P13 R17 R26
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Biological Process
GO:0006334 nucleosome assembly
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5x0x, PDBe:5x0x, PDBj:5x0x
PDBsum5x0x
PubMed28424519
UniProtP62799|H4_XENLA Histone H4

[Back to BioLiP]