Structure of PDB 5wvw Chain B

Receptor sequence
>5wvwB (length=58) Species: 273057 (Saccharolobus solfataricus P2) [Search protein sequence]
SGKKPVKVKTPAGKEAELVPEKVWAAAPKGRKGVKIGLFKDPETGKYFRH
KLPDDYPI
3D structure
PDB5wvw Roles of Leu28 side chain intercalation in the interaction between Cren7 and DNA
ChainB
Resolution1.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna B K37 P59 I60 K35 P57 I58
BS02 dna B K24 W26 A27 A28 A29 P30 K31 L40 Y49 R51 K22 W24 A25 A26 A27 P28 K29 L38 Y47 R49
BS03 dna B R33 K34 I38 R51 H52 K53 R31 K32 I36 R49 H50 K51
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003690 double-stranded DNA binding
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:5wvw, PDBe:5wvw, PDBj:5wvw
PDBsum5wvw
PubMed28377493
UniProtQ97ZE3|CREN7_SACS2 Chromatin protein Cren7 (Gene Name=creN7)

[Back to BioLiP]