Structure of PDB 5wn8 Chain B

Receptor sequence
>5wn8B (length=370) Species: 9606 (Homo sapiens) [Search protein sequence]
KEYHIDEEVGFALPNPQENLPDFYNDWMFIAKHLPDLIESGQLRERVEKL
NMLSIDHLTDHKSQRLARLVLGCITMAYVWGKGHGDVRKVLPRNIAVPYC
QLSKKLELPPILVYADCVLANWKKKDPNKPLTYENMDVLFSFRDGDCSKG
FFLVSLLVEIAAASAIKVIPTVFKAMQMQERDTLLKALLEIASCLEKALQ
VFHQIHDHVNPKAFFSVLRIYLSGWKGNPQLSDGLVYEGFWEDPKEFAGG
SAGQSSVFQCFDVLLGIQQTAGGGHAAQFLQDMRRYMPPAHRNFLCSLES
NPSVREFVLSKGDAGLREAYDACVKALVSLRSYHLQIVTKYILIPASQGT
DLMNFLKTVRSTTEKSLLKE
3D structure
PDB5wn8 Structural insights into substrate and inhibitor binding sites in human indoleamine 2,3-dioxygenase 1.
ChainB
Resolution2.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 1.13.11.52: indoleamine 2,3-dioxygenase.
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 HEM B F163 V170 F214 I217 F226 A264 G265 F270 F291 R343 H346 I349 V350 Y353 I354 L384 F387 V391 F151 V158 F202 I205 F214 A252 G253 F258 F279 R331 H334 I337 V338 Y341 I342 L352 F355 V359
BS02 BBJ B Y126 C129 V130 F163 F164 S167 F226 R231 L234 G262 S263 A264 Y114 C117 V118 F151 F152 S155 F214 R219 L222 G250 S251 A252 BindingDB: IC50=72nM,EC50=8.0nM,Kd=3460nM
Gene Ontology
Molecular Function
GO:0004833 tryptophan 2,3-dioxygenase activity
GO:0009055 electron transfer activity
GO:0016702 oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen
GO:0020037 heme binding
GO:0033754 indoleamine 2,3-dioxygenase activity
GO:0046872 metal ion binding
GO:0051213 dioxygenase activity
Biological Process
GO:0002376 immune system process
GO:0002666 positive regulation of T cell tolerance induction
GO:0002678 positive regulation of chronic inflammatory response
GO:0002830 positive regulation of type 2 immune response
GO:0006569 tryptophan catabolic process
GO:0006954 inflammatory response
GO:0007565 female pregnancy
GO:0019441 tryptophan catabolic process to kynurenine
GO:0019805 quinolinate biosynthetic process
GO:0032496 response to lipopolysaccharide
GO:0032693 negative regulation of interleukin-10 production
GO:0032735 positive regulation of interleukin-12 production
GO:0033555 multicellular organismal response to stress
GO:0034276 kynurenic acid biosynthetic process
GO:0034354 'de novo' NAD biosynthetic process from tryptophan
GO:0036269 swimming behavior
GO:0042098 T cell proliferation
GO:0042130 negative regulation of T cell proliferation
GO:0043065 positive regulation of apoptotic process
GO:0046006 regulation of activated T cell proliferation
GO:0070233 negative regulation of T cell apoptotic process
GO:0070234 positive regulation of T cell apoptotic process
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0030485 smooth muscle contractile fiber
GO:0032421 stereocilium bundle

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:5wn8, PDBe:5wn8, PDBj:5wn8
PDBsum5wn8
PubMed29167421
UniProtP14902|I23O1_HUMAN Indoleamine 2,3-dioxygenase 1 (Gene Name=IDO1)

[Back to BioLiP]