Structure of PDB 5wcu Chain B |
>5wcuB (length=80) Species: 7227 (Drosophila melanogaster) [Search protein sequence] |
RDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTY TEHAKRKTVTAMDVVYALKRQGRTLYGFGG |
|
PDB | 5wcu Revisit of Reconstituted 30-nm Nucleosome Arrays Reveals an Ensemble of Dynamic Structures. |
Chain | B |
Resolution | 5.53 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
dna |
B |
I46 S47 G48 |
I24 S25 G26 |
|
|
|
|