Structure of PDB 5wbv Chain B

Receptor sequence

>5wbvB (length=227) Species: 9606 (Homo sapiens)

GMSAKELCENDDLATSLVLDPYLGFQTHKMNKGRQEELKEVIERFKKDEH
LEKAFKCLTSFLNKNKMQEKLFKEHVFIYLRMFATDSGFEILPCNRYSSE
QNGAKIVATKEWKRNDKIELLVGCIAELSEIEENMLLRHGENDFSVMYST
RKNCAQLWLGPAAFINHDCRPNCKFVSTGRDTACVKALRDIEPGEEISCY
YGDGFFGENNEFCECYTCERRGTGAFK

3D structure

• PDB: 5wbv Crystal Structure of the SET Domain of Human SUV420H1 In Complex With Inhibitor
• Chain: B
• Resolution: 2.3 Å

Enzymatic activity

• Enzyme Commision number: 2.1.1.361: [histone H4]-lysine(20) N-methyltransferase.
  2.1.1.362: [histone H4]-N-methyl-L-lysine(20) N-methyltransferase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	9ZY	B	R244 H245	R138 H139
BS02	ZN	B	C275 C319 C324	C169 C213 C218
BS03	SAM	B	H98 Y203 S205 E206 G209 A210 F250 A269 F270 N272 H273 Y307 F312	H28 Y97 S99 E100 G103 A104 F144 A163 F164 N166 H167 Y201 F206
BS04	9ZY	B	G229 S251 V252 M253 W264 A268 F281 A289 Y307 F311	G123 S145 V146 M147 W158 A162 F175 A183 Y201 F205

Gene Ontology

Molecular Function

• GO:0042799 histone H4K20 methyltransferase activity

External links

• PDB: RCSB:5wbv, PDBe:5wbv, PDBj:5wbv
• PDBsum: 5wbv
• UniProt: Q4FZB7|KMT5B_HUMAN Histone-lysine N-methyltransferase KMT5B (Gene Name=KMT5B)