Structure of PDB 5w4c Chain B

Receptor sequence

>5w4cB (length=338) Species: 235443 (Cryptococcus neoformans var. grubii H99)

FGVREPKRTGEVSKKMHSKVVIIGSGPGGHTAAIYLARANLEPVLYEGML
ANGFAPGGQLTTTTDVENFPGFPEGVTGTEMMDKFRAQSERFGTKIITET
VARVDLSVRPFKYWTEGEEEEHEFMTADTIILATGASAKRLFLPGEETYW
QSGISACAVCDGAVPIFRQKPLAVIGGGDSAAEEATYLTKYGSHVYVLVR
RDELRASKIMAKRLTSHPKVTVLWNTVATEAKGDGEVLTSLTIKNTKTGE
TGDLPVNGLFYAIGHEPATSLVKSQVELDSDGYIKTVPGTSQTSVHGVFA
AGDVQDKKYRQAITSAGSGCIAALEAERLISEEEADDE

3D structure

• PDB: 5w4c Crystal structure of thioredoxin reductase from Cryptococcus neoformans in complex with FAD (FO conformation)
• Chain: B
• Resolution: 2.255 Å

Enzymatic activity

• Enzyme Commision number: 1.8.1.9: thioredoxin-disulfide reductase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	FAD	B	I36 G37 S38 G39 P40 G41 Y59 G61 A64 N65 G71 Q72 L73 T76 N81 T113 V114 T147 G148 C173 G315 D316 R323 Q324 A325 S328	I23 G24 S25 G26 P27 G28 Y46 G48 A51 N52 G58 Q59 L60 T63 N68 T100 V101 T134 G135 C160 G302 D303 R310 Q311 A312 S315
BS02	CA	B	E112 E129 E131	E99 E116 E118

Gene Ontology

Molecular Function

• GO:0000166 nucleotide binding
• GO:0004791 thioredoxin-disulfide reductase (NADPH) activity
• GO:0016491 oxidoreductase activity
• GO:0046872 metal ion binding

Biological Process

• GO:0019430 removal of superoxide radicals
• GO:0045454 cell redox homeostasis

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol

External links

• PDB: RCSB:5w4c, PDBe:5w4c, PDBj:5w4c
• PDBsum: 5w4c
• UniProt: J9VRX9