Structure of PDB 5vjj Chain B

Receptor sequence
>5vjjB (length=75) Species: 5261 (Melampsora lini) [Search protein sequence]
NQELGVVQCLCRRIAPLTQPPFGVRCRATLNCPCDYIGDCPGPAEQYMYR
CPNCGPRSHVACSGVHQGTCQQVHP
3D structure
PDB5vjj Crystal structure of the Melampsora lini effector AvrP reveals insights into a possible nuclear function and recognition by the flax disease resistance protein P.
ChainB
Resolution2.52 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 ZN B C36 C38 C78 C81 C9 C11 C51 C54
BS02 ZN B C53 C67 C89 H93 C26 C40 C62 H66
BS03 ZN B C59 C61 C97 H101 C32 C34 C70 H74
External links