Structure of PDB 5vgt Chain B |
>5vgtB (length=113) Species: 10761 (Lederbergvirus Sf6) [Search protein sequence] |
VLTKGEIVLFALRKFAIASNASLTDVEPQSIEDGVNDLEDMMSEWMINPG DIGYAFATGDEQPLPDDESGLPRKYKHAVGYQLLLRMLSDYSLEPTPQVL SNAQRSYDALMTD |
|
PDB | 5vgt High-resolution structure of podovirus tail adaptor suggests repositioning of an octad motif that mediates the sequential tail assembly. |
Chain | B |
Resolution | 1.776 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CA |
B |
D43 E47 |
D40 E44 |
|
|
|