Structure of PDB 5vbn Chain B

Receptor sequence

>5vbnB (length=125) Species: 9606 (Homo sapiens)

SYVLPEVICRSCNFCRDLDLCKDSSPQWLCSNCQAPYDSSAIEMTLVEVL
QKKLMAFTLQDLVCLKCRGVKETSMPVYCSCAGDFALTIHTQVFMEQIGI
FRNIAQHYGMSYLLETLEWLLQKNP

3D structure

• PDB: 5vbn Crystal structure of the human Pol B-subunit in complex with the C-terminal domain of the catalytic subunit.
• Chain: B
• Resolution: 2.35 Å

Enzymatic activity

• Enzyme Commision number: 2.7.7.7: DNA-directed DNA polymerase.
  3.1.11.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ZN	B	C2158 C2187 C2190	C9 C30 C33
BS02	ZN	B	C2221 C2224 C2236	C64 C67 C79

Gene Ontology

Molecular Function

• GO:0003677 DNA binding
• GO:0003887 DNA-directed DNA polymerase activity

Biological Process

• GO:0006260 DNA replication
• GO:0006281 DNA repair

Cellular Component

• GO:0008622 epsilon DNA polymerase complex

External links

• PDB: RCSB:5vbn, PDBe:5vbn, PDBj:5vbn
• PDBsum: 5vbn
• PubMed: 28747437
• UniProt: Q07864|DPOE1_HUMAN DNA polymerase epsilon catalytic subunit A (Gene Name=POLE)