Structure of PDB 5v6u Chain B

Receptor sequence
>5v6uB (length=213) Species: 9606 (Homo sapiens) [Search protein sequence]
TTRDRTYQYNMNFEKLGKCIIINNKNFDKVTGMGVRNGTDKDAEALFKCF
RSLGFDVIVYNDCSCAKMQDLLKKASEEDHTNAACFACILLSHGEENVIY
GKDGVTPIKDLTAHFRGDRCKTLLEKPKLFFIQACRKIPVEADFLFAYST
VPSWRSPGRGSWFVQALCSILEEHGKDLEIMQILTRVNDRVARHFKQIPC
VVSMLTKELYFSQ
3D structure
PDB5v6u Allosteric Tuning of Caspase-7: A Fragment-Based Drug Discovery Approach.
ChainB
Resolution2.8 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) G85 V86 H144 G145 C186
Catalytic site (residue number reindexed from 1) G34 V35 H93 G94 C135
Enzyme Commision number 3.4.22.60: caspase-7.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 8YM B K160 T163 A164 R167 E216 F219 F221 Y223 M294 K109 T112 A113 R116 E141 F144 F146 Y148 M204 PDBbind-CN: -logKd/Ki=2.26,Ki=5470uM
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0004190 aspartic-type endopeptidase activity
GO:0004197 cysteine-type endopeptidase activity
GO:0005515 protein binding
GO:0008233 peptidase activity
GO:0008234 cysteine-type peptidase activity
GO:0097153 cysteine-type endopeptidase activity involved in apoptotic process
GO:0097200 cysteine-type endopeptidase activity involved in execution phase of apoptosis
Biological Process
GO:0006508 proteolysis
GO:0006915 apoptotic process
GO:0007507 heart development
GO:0009411 response to UV
GO:0016485 protein processing
GO:0030163 protein catabolic process
GO:0042742 defense response to bacterium
GO:0043525 positive regulation of neuron apoptotic process
GO:0044346 fibroblast apoptotic process
GO:0051146 striated muscle cell differentiation
GO:0051402 neuron apoptotic process
GO:0051604 protein maturation
GO:0070227 lymphocyte apoptotic process
GO:0071222 cellular response to lipopolysaccharide
GO:0071887 leukocyte apoptotic process
GO:0072734 cellular response to staurosporine
GO:0097194 execution phase of apoptosis
GO:1905686 positive regulation of plasma membrane repair
Cellular Component
GO:0005576 extracellular region
GO:0005615 extracellular space
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005737 cytoplasm
GO:0005829 cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5v6u, PDBe:5v6u, PDBj:5v6u
PDBsum5v6u
PubMed28940929
UniProtP55210|CASP7_HUMAN Caspase-7 (Gene Name=CASP7)

[Back to BioLiP]