Structure of PDB 5uwx Chain B

Receptor sequence

>5uwxB (length=344) Species: 1502 (Clostridium perfringens)

ARILKTAYTFDDVLLVPNKSEVLPNEVSLKTQLTKKIQLNIPLMSASMDT
VTESKMAIAMAREGGIGIIHKNMTIEDQAREVDRVKRSGGLLCGASIGVT
NDMMERVDAVVKAKVDVIVLDTAHGHSKGVIEGVKRIKAKYPELQVIAGN
IATPEAVRDLAEAGADCVKVGIGPGSICTTRIVAGVGVPQLTAVMDCAEE
GKKLGIPVIADGGLKYSGDIVKALAAGACAAMMGSIFAGCEEAPGAIEIY
QGRSYKVYRGMGSLGAMAKFVPEGVEGRIAYKGHLADTIYQLIGGIKSGM
GYLGAPTLENLYENANFVVQTSAGFRESHPHDINITKEAPNYSV

3D structure

• PDB: 5uwx Crystal Structure of Inosine 5'-monophosphate Dehydrogenase from Clostridium perfringens Complexed with IMP and P176
• Chain: B
• Resolution: 1.85 Å

Enzymatic activity

• Enzyme Commision number: 1.1.1.205: IMP dehydrogenase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	8L7	B	P25 S436 G439 Y440	P24 S298 G301 Y302
BS02	8L7	B	V224 A248 H249 S252 G254 M386 G387 M392 E411	V99 A123 H124 S127 G129 M261 G262 M267 E273
BS03	IMP	B	M49 G300 S301 I302 C303 D336 G338 G359 S360 Y383 G385 M386 G387 E411	M48 G175 S176 I177 C178 D211 G213 G234 S235 Y258 G260 M261 G262 E273

Gene Ontology

Molecular Function

• GO:0003824 catalytic activity
• GO:0003938 IMP dehydrogenase activity
• GO:0016491 oxidoreductase activity

Biological Process

• GO:0006164 purine nucleotide biosynthetic process

External links

• PDB: RCSB:5uwx, PDBe:5uwx, PDBj:5uwx
• PDBsum: 5uwx
• UniProt: A0A127ELD1