Structure of PDB 5urq Chain B

Receptor sequence

>5urqB (length=356) Species: 32022 (Campylobacter jejuni subsp. jejuni)

NAMKIVKRALTFEDVLLRPGYSEVLPKEVKIHTKLTKNITLNMPLISAAM
DTVTEHRAAIMMARLGGLGVIHKNMDIASQVREVKRVKKSEKEYPDANKD
NFGRLRVGAAIGVGQMDRVDALVEAGVDVVVLDSAHGHSKGIIDTVKAIK
AKYPNLDLIAGNIATAAAAKALCEAGVDAVKVGIGPGSICTTRIVSGVGV
PQISAIDECVEEANKFGVPVIADGGIKYSGDIAKALAVGASSVMIGSLLA
GTDESPGELFTYQGRQYKSYRGMGSLGAMQKKLVPEGIEGRVPYVGSIRS
VVHQLLGGLRSSMGYVGAKDIEDFQKRAEFVEITTAGLKESHVHDVTITH
EAPNYK

3D structure

• PDB: 5urq Crystal Structure of the Catalytic Domain of the Inosine Monophosphate Dehydrogenase from Campylobacter jejuni in the complex with inhibitor p176
• Chain: B
• Resolution: 2.7 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	IMP	B	M48 G298 S299 I300 C301 D334 G335 G357 S358 Y381 G383 M384 G385 E411	M50 G187 S188 I189 C190 D223 G224 G246 S247 Y270 G272 M273 G274 E286
BS02	8L7	B	V224 S245 A246 S250 G252 M384 G385 E411	V113 S134 A135 S139 G141 M273 G274 E286
BS03	8L7	B	S436 G439 Y440	S311 G314 Y315

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Fri Nov 29 06:31:54 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '5urq', asym_id = 'B', title = 'Crystal Structure of the Catalytic Domain of the...bacter jejuni in the complex with inhibitor p176 '

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='5urq', asym_id='B', title='Crystal Structure of the Catalytic Domain of the...bacter jejuni in the complex with inhibitor p176 ')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0003824,0003938,0006164,0016491', uniprot = '', pdbid = '5urq', asym_id = 'B'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003824,0003938,0006164,0016491', uniprot='', pdbid='5urq', asym_id='B')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>