Structure of PDB 5uim Chain B

Receptor sequence

>5uimB (length=397) Species: 28901 (Salmonella enterica)

MKIIIAGKNDIAVNVTRWLQKKKKNIEIYAICNANDTGIDTFQRSFKKYC
KDNLIPIISLAEAYKIDDAIFLSLEFDKIVQPSKFNHNELFNIHFSYLPK
YKGMYTSAWPILNGEDTSGVTLHKIDHGIDTGAIIAQKEIIIQPFETAKD
LYEKYISEGTSLVIDNISTLLNSEYVEKEQNIKYSSYYSKKTIDYSNLEL
NFSKTAFEIINQLRAFTFREYQLPKLDGVNIFLGDVLSSRSIMKPGSILE
RNDKEIIVSTIDYDVVLYKDNFKEILEACKYSDSKYIAKLIRAKSILFEK
NIYGWSPVIVAAYHGNIELIKWLVSKGANINDRNYKGTTVAMYFKDYMLK
SGDYSGLKMLIDLGLDLTLTDYKDYTVFDYLEKSGNKNLLQYMMAFM

3D structure

• PDB: 5uim Molecular architecture of an N-formyltransferase from Salmonella enterica O60.
• Chain: B
• Resolution: 2.2 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): N92 H94 T121 D130
• Catalytic site (residue number reindexed from 1): N92 H94 T121 D130

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	FON	B	F76 K78 I79 V80 N92 I125 D126 G128 D130 Y187 S189 K190	F76 K78 I79 V80 N92 I125 D126 G128 D130 Y187 S189 K190
BS02	T3Q	B	W305 Y313 H314 N334 T338 M342 Y343 D346 Y380	W305 Y313 H314 N334 T338 M342 Y343 D346 Y380
BS03	TYD	B	Y105 S107 Y152 Y195 F218 Y221 Q222	Y105 S107 Y152 Y195 F218 Y221 Q222

Gene Ontology

Molecular Function

• GO:0003824 catalytic activity
• GO:0004479 methionyl-tRNA formyltransferase activity
• GO:0016740 transferase activity

Biological Process

• GO:0006413 translational initiation
• GO:0009058 biosynthetic process
• GO:0071951 conversion of methionyl-tRNA to N-formyl-methionyl-tRNA

Cellular Component

• GO:0005829 cytosol

External links

• PDB: RCSB:5uim, PDBe:5uim, PDBj:5uim
• PDBsum: 5uim
• PubMed: 28263875
• UniProt: U3GK13