Structure of PDB 5u91 Chain B

Receptor sequence

>5u91B (length=327) Species: 32630 (synthetic construct)

PADATSDEVRKNLMDVFRDRPAFSEHTWEMLLSVCRSWAAWCKLNNRKWF
PAEPEDVRDYLLHLQARGLAVKTIQQHLCRLNMLHRRSGLPRPSDSNAVS
LVMRRIRKENVDAGERTKQALAFERTDFDQVRSLMENSDRCQDIRNLAFL
GVAYNTLLRIAEIARIRVKDISRTDGGRMLIHIGRTKTLVSTAGVEKALS
LGVTKLVERWISVSGVADDPNNYLFCRVRRYGVAAPSATSQLSTYALQRI
FEATHRLIYGAKDDSGQRYLAWSGHSARVGAARDMARAGVSIPEIMQAGG
WTTVNSVMNFIRNLDSETGAMVRLLED

3D structure

• PDB: 5u91 Crystal structure of an engineered, HIV-specific recombinase for removal of integrated proviral DNA.
• Chain: B
• Resolution: 3.104 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	B	M44 S47 R50 L83 A84 T87 Q90 K122 T131 K132 Q156 R159 R173 K201 T202 R241 V242 R244 L256 S257 Y259 A260 R282 H289 R292 W315 T316 T317 S320 F324	M30 S33 R36 L69 A70 T73 Q76 K108 T117 K118 Q142 R145 R159 K187 T188 R227 V228 R230 L242 S243 Y245 A246 R268 H275 R278 W301 T302 T303 S306 F310
BS02	dna	B	F37 S38 H40 Q89 Q90 R94 M97 R100 S108 R118 R121 I174 A175 K201 R243 Q262 R282 Y283 S287 G288	F23 S24 H26 Q75 Q76 R80 M83 R86 S94 R104 R107 I160 A161 K187 R229 Q248 R268 Y269 S273 G274

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Sun Nov 17 01:33:08 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '5u91', asym_id = 'B', title = 'Crystal structure of an engineered, HIV-specific recombinase for removal of integrated proviral DNA.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='5u91', asym_id='B', title='Crystal structure of an engineered, HIV-specific recombinase for removal of integrated proviral DNA.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0003677,0006310,0015074', uniprot = '', pdbid = '5u91', asym_id = 'B'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003677,0006310,0015074', uniprot='', pdbid='5u91', asym_id='B')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>