Structure of PDB 5u2j Chain B

Receptor sequence

>5u2jB (length=110) Species: 9606 (Homo sapiens)

DPIPICSFCLGTKESNREKKPEELLSCADCGSSGHPSCLKFCPELTTNVK
ALRWQCIECKTCSACRVQGRNADNMLFCDSCDRGFHMECCDPPLSRMPKG
MWICQVCRPK

3D structure

• PDB: 5u2j Recognition of Histone H3K14 Acylation by MORF.
• Chain: B
• Resolution: 1.6 Å

Enzymatic activity

• Enzyme Commision number: 2.3.1.48: histone acetyltransferase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	B	S210 F211 L213 S236 K243 I260 E261 A275 M278 L279 F280 D282 D285 M300 P301 G303	S7 F8 L10 S33 K40 I57 E58 A72 M75 L76 F77 D79 D82 M97 P98 G100
BS02	ZN	B	C281 C284 C307 C310	C78 C81 C104 C107
BS03	ZN	B	C265 C268 H289 C292	C62 C65 H86 C89
BS04	ZN	B	C209 C212 H238 C241	C6 C9 H35 C38
BS05	ZN	B	C230 C233 C259 C262	C27 C30 C56 C59

External links

• PDB: RCSB:5u2j, PDBe:5u2j, PDBj:5u2j
• PDBsum: 5u2j
• PubMed: 28286003
• UniProt: Q8WYB5|KAT6B_HUMAN Histone acetyltransferase KAT6B (Gene Name=KAT6B)