Structure of PDB 5tuy Chain B

Receptor sequence

>5tuyB (length=263) Species: 9606 (Homo sapiens)

CRDVARGYENVPIPCVNGVDGEPCPEDYKYISENCETSTMNIDRNITHLQ
HCTCVDDCSSSNCLCGQLSIRCWYDKDGRLLQEFNKIEPPLIFECNQACS
CWRNCKNRVVQSGIKVRLQLYRTAKMGWGVRALQTIPQGTFICEYVGELI
SDAEADVREDDSYLFDLDGEVYCIDARYYGNISRFINHLCDPNIIPVRVF
MLHQDLRFPRIAFFSSRDIRTGEELGFDYGDRFWDIKSKYFTCQCGSEKC
KHSAEAIALEQSK

3D structure

• PDB: 5tuy Discovery of Potent and Selective Inhibitors for G9a-Like Protein (GLP) Lysine Methyltransferase.
• Chain: B
• Resolution: 2.6 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): Y1067 Y1154
• Catalytic site (residue number reindexed from 1): Y145 Y229
• Enzyme Commision number: 2.1.1.-
  2.1.1.367: [histone H3]-lysine(9) N-methyltransferase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ZN	B	C980 C1017 C1023 C1027	C58 C95 C101 C105
BS02	ZN	B	C974 C987 C1017 C1021	C52 C65 C95 C99
BS03	ZN	B	C974 C976 C980 C985	C52 C54 C58 C63
BS04	ZN	B	C1115 C1168 C1170 C1175	C190 C243 C245 C250
BS05	SAM	B	M1048 G1049 W1050 S1084 Y1085 R1109 F1110 N1112 H1113 Y1154 F1166 C1168 Q1169	M126 G127 W128 S162 Y163 R184 F185 N187 H188 Y229 F241 C243 Q244
BS06	7L6	B	A1077 D1078 D1083 L1086 D1088 F1158 I1161 K1162	A155 D156 D161 L164 D166 F233 I236 K237	BindingDB: IC50=1.6nM,Kd=445nM

Gene Ontology

Molecular Function

• GO:0002039 p53 binding
• GO:0008270 zinc ion binding
• GO:0016279 protein-lysine N-methyltransferase activity
• GO:0042054 histone methyltransferase activity

Cellular Component

• GO:0005634 nucleus

External links

• PDB: RCSB:5tuy, PDBe:5tuy, PDBj:5tuy
• PDBsum: 5tuy
• PubMed: 28135087
• UniProt: Q96KQ7|EHMT2_HUMAN Histone-lysine N-methyltransferase EHMT2 (Gene Name=EHMT2)