Structure of PDB 5tio Chain B

Receptor sequence

>5tioB (length=343) Species: 9606 (Homo sapiens)

APMSPSDFLDKLMGRTSGYDARIRPNFKGPPVNVTCNIFINSFGSIAETT
MDYRVNIFLRQKWNDPRLAYSEYPDDSLDLDPSMLDSIWKPDLFFANEKG
ANFHEVTTDNKLLRIFKNGNVLYSIRLTLTLSCPMDLKNFPMDVQTCIMQ
LESFGYTMNDLIFEWQDEAPVQVAEGLTLPQFLLKEEKDLRYCTKHYNTG
KFTCIEVRFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVAL
GITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLFVFSALLEYAAVN
FVSRAGTKVFIDRAKKIDTISRACFPLAFLIFNIFYWVIYKIL

3D structure

• PDB: 5tio Crystal Structures of Human GlyRa3 Bound to a Novel Class of Potentiators with Efficacy in a Mouse Model of Neuropathic Pain
• Chain: B
• Resolution: 3.25 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	7C6	B	P10 Y78 L83 D84 L85	P5 Y73 L78 D79 L80	BindingDB: EC50=50nM,Kd=11nM
BS02	GLY	B	F63 R65 S129	F58 R60 S124
BS03	7C6	B	I28 R29 F32 G160 Y161	I23 R24 F27 G155 Y156	BindingDB: EC50=50nM,Kd=11nM
BS04	GLY	B	F159 T204	F154 T199
BS05	ZN	B	E192 D194 H215	E187 D189 H210

Gene Ontology

Molecular Function

• GO:0004888 transmembrane signaling receptor activity
• GO:0005216 monoatomic ion channel activity
• GO:0005230 extracellular ligand-gated monoatomic ion channel activity
• GO:0016594 glycine binding
• GO:0022824 transmitter-gated monoatomic ion channel activity

Biological Process

• GO:0006811 monoatomic ion transport
• GO:0034220 monoatomic ion transmembrane transport

Cellular Component

• GO:0005886 plasma membrane
• GO:0016020 membrane

External links

• PDB: RCSB:5tio, PDBe:5tio, PDBj:5tio
• PDBsum: 5tio
• UniProt: O75311|GLRA3_HUMAN Glycine receptor subunit alpha-3 (Gene Name=GLRA3)