Structure of PDB 5tin Chain B

Receptor sequence

>5tinB (length=343) Species: 9606 (Homo sapiens)

APMSPSDFLDKLMGRTSGYDARIRPNFKGPPVQVTCNIFINSFGSIAETT
MDYRVNIFLRQKWNDPRLAYSEYPDDSLDLDPSMLDSIWKPDLFFANEKG
ANFHEVTTDNKLLRIFKNGNVLYSIRLTLTLSCPMDLKNFPMDVQTCIMQ
LESFGYTMNDLIFEWQDEAPVQVAEGLTLPQFLLKEEKDLRYCTKHYNTG
KFTCIEVRFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVAL
GITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLFVFSALLEYAAVN
FVSRAGTKVFIDRAKKIDTISRACFPLAFLIFNIFYWVIYKIL

3D structure

• PDB: 5tin Crystal Structures of Human GlyRa3 Bound to a Novel Class of Potentiators with Efficacy in a Mouse Model of Neuropathic Pain
• Chain: B
• Resolution: 2.61 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	7C6	B	P10 Y78 D84 L85 D86	P5 Y73 D79 L80 D81	BindingDB: EC50=50nM,Kd=11nM
BS02	GLY	B	F63 R65 S129	F58 R60 S124
BS03	7C6	B	R27 I28 R29 F32 G160 Y161	R22 I23 R24 F27 G155 Y156	BindingDB: EC50=50nM,Kd=11nM
BS04	GLY	B	F159 T204	F154 T199
BS05	ZN	B	E192 D194 H215	E187 D189 H210

Gene Ontology

Molecular Function

• GO:0004888 transmembrane signaling receptor activity
• GO:0005216 monoatomic ion channel activity
• GO:0005230 extracellular ligand-gated monoatomic ion channel activity
• GO:0016594 glycine binding
• GO:0022824 transmitter-gated monoatomic ion channel activity

Biological Process

• GO:0006811 monoatomic ion transport
• GO:0034220 monoatomic ion transmembrane transport

Cellular Component

• GO:0005886 plasma membrane
• GO:0016020 membrane

External links

• PDB: RCSB:5tin, PDBe:5tin, PDBj:5tin
• PDBsum: 5tin
• UniProt: O75311|GLRA3_HUMAN Glycine receptor subunit alpha-3 (Gene Name=GLRA3)