Structure of PDB 5th3 Chain B

Receptor sequence

>5th3B (length=226) Species: 1292 (Staphylococcus warneri)

MNFKKYEENLVASIEEVIQRIIDDKHRPNIIGKTRVGAEVSDYLEDEFVK
YISSGKSSSLYDAQGAPKEKTKNPWDARCKFKFMDREEEIWIDFKAFKIT
NMDSNPDIGTPNKIVKFIHEGNFYLVFVLVYYESKQDGVEFVKYNNDYKK
VYLLKDVNESFRINPKPQMQVNIAAEPTYRTREEFIHFFVKKWKESFERQ
IKSLEKKEIMLKDLEDKLKNSNDNSI

3D structure

• PDB: 5th3 DNA recognition by the SwaI restriction endonuclease involves unusual distortion of an 8 base pair A:T-rich target.
• Chain: B
• Resolution: 2.33 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	B	R35 N164 K166 Q170 R199	R35 N164 K166 Q170 R199
BS02	dna	B	R35 K70 T71 K72	R35 K70 T71 K72
BS03	dna	B	T71 K72 G109 T110 K113 Q168	T71 K72 G109 T110 K113 Q168
BS04	dna	B	R35 S41 D76 K95 A96 F97 K98 N101 M102 D103 S104 N105 P106 D107 Q170	R35 S41 D76 K95 A96 F97 K98 N101 M102 D103 S104 N105 P106 D107 Q170
BS05	MG	B	D76 D93 F94	D76 D93 F94

Gene Ontology

Molecular Function

• GO:0046872 metal ion binding

External links

• PDB: RCSB:5th3, PDBe:5th3, PDBj:5th3
• PDBsum: 5th3
• PubMed: 28180307
• UniProt: A0A1S4NYF7