Structure of PDB 5t90 Chain B |
>5t90B (length=197) Species: 6523 (Lymnaea stagnalis) [Search protein sequence] |
LDRADILYNIRQTSRPDVIPTQRDRPVAVSVSLKFINILEVNENEVDVVF WQQTTWSDRTLAWNSSHSPDQVSVPISSLWVPDLAAYNAISKPEVLTPQL ARVVSDGEVLYMPSIRQRFSCDVSGVDTESGATCRIKIGSWTHHSREISV DPDSEYFSQYSRFEILDVTQKKNSVTYSCCPEAYEDVEVSLNFRKKG |
|
PDB | 5t90 Structural mechanisms for alpha-conotoxin activity at the human alpha 3 beta 4 nicotinic acetylcholine receptor. |
Chain | B |
Resolution | 2.8 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
|
|
Molecular Function |
GO:0004888 |
transmembrane signaling receptor activity |
GO:0005216 |
monoatomic ion channel activity |
GO:0005230 |
extracellular ligand-gated monoatomic ion channel activity |
GO:0005231 |
excitatory extracellular ligand-gated monoatomic ion channel activity |
GO:1904315 |
transmitter-gated monoatomic ion channel activity involved in regulation of postsynaptic membrane potential |
|
|