Structure of PDB 5t8h Chain B

Receptor sequence

>5t8hB (length=99) Species: 11676 (Human immunodeficiency virus 1)

PQITLWKRPLVTIKIGGQLKEALLDTGADDTIIEEMSLPGRWKPKMVGGI
GGFIKVRQYDQIIIEIAGHKAIGTVLVGPTPINIIGRNLLTQIGATLNF

3D structure

• PDB: 5t8h Room Temperature Neutron Crystallography of Drug Resistant HIV-1 Protease Uncovers Limitations of X-ray Structural Analysis at 100 K.
• Chain: B
• Resolution: 1.85 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): D125 T126 G127
• Catalytic site (residue number reindexed from 1): D25 T26 G27

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	478	B	D125 A128 D130 I132 V147 G149 I150 P181 I182	D25 A28 D30 I32 V47 G49 I50 P81 I82

Gene Ontology

Molecular Function

• GO:0004190 aspartic-type endopeptidase activity
• GO:0042802 identical protein binding

Biological Process

• GO:0006508 proteolysis

External links

• PDB: RCSB:5t8h, PDBe:5t8h, PDBj:5t8h
• PDBsum: 5t8h
• PubMed: 28195728
• UniProt: Q7SSI0